PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6BL_CE61B9510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 197aa    MW: 21924.9 Da    PI: 10.529
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6BL_CE61B9510.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.5e-1668115148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            +g W++eEd++l d++ ++G g+W++ +++ g+ R +k+c++rw +yl
  Traes_6BL_CE61B9510.1  68 KGLWSPEEDQKLRDYILRHGHGCWSALPAKAGLQRNGKSCRLRWINYL 115
                            678*******************************************97 PP

2Myb_DNA-binding54.72.4e-17122166248
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            g +++eE+e    +++ lG++ W++Iar+++ gRt++++k++w++yl
  Traes_6BL_CE61B9510.1 122 GMFSPEEEETVMSLHAALGNK-WSRIARHLP-GRTDNEVKNYWNSYL 166
                            569******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.81963115IPR017930Myb domain
SuperFamilySSF466893.99E-2965162IPR009057Homeodomain-like
SMARTSM007175.3E-1167117IPR001005SANT/Myb domain
PfamPF002495.5E-1468115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-2269121IPR009057Homeodomain-like
CDDcd001676.50E-1071115No hitNo description
PROSITE profilePS5129425.123116170IPR017930Myb domain
SMARTSM007176.3E-14120168IPR001005SANT/Myb domain
PfamPF002499.1E-16122166IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-26122169IPR009057Homeodomain-like
CDDcd001672.15E-11124166No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MAIKLPPTAP LWKRQNAPPS QPRLEPEASA TAAASCTPLR GFVPRRSSAC KQAMGCKACD  60
KPRPSYRKGL WSPEEDQKLR DYILRHGHGC WSALPAKAGL QRNGKSCRLR WINYLRPGLK  120
HGMFSPEEEE TVMSLHAALG NKWSRIARHL PGRTDNEVKN YWNSYLKKRV EGGKEAPNSP  180
NRHAASSAAE SDGSQSQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-27641713109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0387441e-147BT038744.1 Zea mays full-length cDNA clone ZM_BFb0323B03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569964.11e-86PREDICTED: transcription factor LAF1
SwissprotQ9M0K47e-57LAF1_ARATH; Transcription factor LAF1
TrEMBLW5GMS11e-144W5GMS1_WHEAT; Uncharacterized protein
STRINGBRADI3G49970.13e-86(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.13e-58myb domain protein 19
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]